자원등록 시스템

구분
공통정보세트 ( * ) 항목은 필수값 입니다.
학명
(Scientific Name)
상위분류군 ex) Pinaceae (Family 등)
* 속명 ex) Haliclona
아속명 ex) Gellius
* 종소명 ex) elegans
동종이명 (Synonym) ex) Rhabditis elegans
일반명 (Common Name) ex) Pine
국명 (Korean Name) ex) 소나무
계통명 (Line Name) ex) 수원1호
품종명 (Variety Name) ex) 통일벼
분류체계
(Taxonomy)

ex) Animalia(동물계) > Arthropoda(절지동물문) > Insecta(곤충강) > Lepidoptera(나비목) > Papilionidae(호랑나비과)
> Papilio(호랑나비속); NCBI
* 기관명 (Institution) ex) 한국생명공학연구원 생명자원센터
* 대구분 ex) 미생물
* 중구분 ex) 균주
부처(기관)별 자원구분 ex) 표본
상세정보 URL
(URL For Detail Information)

ex) http://www.naris.go.kr/v2/naris_search/search_result_detail.jsp?sno=O&inst_id=1008006
핵심어 (Keywords) ex) 벼
등록자 메일주소
관찰
관찰위치 위도좌표 ex) 34.7430185
경도좌표 ex) 128.032001
분양정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
표본
형태적 특징
ex) 줄기는 곧추서며, 높이 3~4m, 속은 흰색 또는 연한 갈색, 가지를 많이 치고 전체에 짧은 별 모양의 털이 있다. 겨울눈은 난형으로 4개의 비늘잎이 있다. 잎은 마주나며, 잎자루는 길이 2~6mm, 턱잎이 있다.
주소 한글주소 ex) 전라남도 진도군 지산면
영문주소 ex) Jeollanam-doJindo-gunJisan-myeon
GPS 위도좌표 ex) 34.4256261
경도좌표 ex) 126.1673487
채집자 ex) 임용석, 서안나
채집일 ex) 2013-07-10
국가 ex) 대한민국
대양 ex) 태평양
ex) 제주도
표본타입 ex) 완모식표본
표본종류 ex) 건조표본
표본공개여부 ex) 공개
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
개체
개체유형 ex) wild-type
개체유지방법 ex) 무작위교배
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
기관
기관유형 ex) lung
질병 ex) cancer
저장 정보 저장 장소 ex) 액체질소탱크
저장장소 일련번호 ex) 1247
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
조직
분리원 ex) liver, leaf, stem
질병 ex) cancer
저장 정보 저장 장소 ex) 액체질소탱크
저장장소 일련번호 ex) 1247
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
배아
배아유형 ex) fertilized egg
저장 정보 저장 장소 ex) 액체질소탱크
저장장소 일련번호 ex) 1247
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
종자
종자상태 ex) 야생종
저장 정보 저장 장소 ex) 액체질소탱크
저장장소 일련번호 ex) 1247
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
세포, 세포주
분리원 ex) stomach, liver
세포(주)유형
ex) stem cell, Hybridoma, Epithelial-like, Lymphoblast, Fibroblast-like 등
세포주명 ex) BCE C/D-1b, hs-103-3 등
배양 정보 배지명 ex) Mannitol Agar/YPM MEDIUM
배양조건 C/PH/빛
계대일
계대시기
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
균주
분리원 ex) soil, water 등
병원성 유무 ex) Y
균주명 ex) Mahoney주, MEF-1주 등
배양 정보 배지명 ex) Mannitol Agar/YPM MEDIUM
배양조건 C/PH/빛
계대일
계대시기
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
체액
체액유형 ex) blood, saliva 등
배양 정보 배지명 ex) Mannitol Agar/YPM MEDIUM
배양조건 C/PH/빛
계대일
계대시기
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
DNA, RNA, Protein 유래물
분리원 ex) lung, liver, hair 등
상세타입 ex) DNA〮RNA〮Protein중 기입
보관유형 ex) cDNA
저장 정보 저장 장소 ex) 액체질소탱크
저장장소 일련번호 ex) 1247
시료종류 종류 ex) cDNA Clone
상세정보
기타정보
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
추출물
분리원 ex) 잎
추출물정보 추출용매 ex) Methanol 99.9%
채취시기 ex) 2001-02-13
분양 정보 분양여부 ex) 가능
분양정보 URL
ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
핵산서열정보
분리원 ex) kidney
분자타입 ex) genomicDNA
데이터유형 ex) GeneralDNA
유전자이름 ex) ATP5A1
등록번호 ex) JQ823644
핵산서열데이터
ex) ctgtggatag cctggtgccg attggccgag gtcagcgtga gctgattatt ggagacagac
공개정보 공개여부 ex) Y
공개정보 URL
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
발현정보
분리원
ex) Human skin biopsy from psoriatic patient 등
데이터유형 ex) Array-based data
발현데이터
ex) GGGCAGTAGCGACCACAGCGGGAGAAGCAGCACTCTAGCCGCCTGTAACCCCAACCTGGG
공개정보 공개여부 ex) Y
공개정보 URL
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
단백질 서열정보
분리원 ex) mouse liver
단백질이름 ex) putative RNA binding protein
등록번호 ex) AET62573.1
단백질서열데이터
ex) DLPAPSNISSWWNFGSLLGVCLMIQIITGLFLAMHYTSDTLTAFSSVTHICRDVNYGWLIRYLHANGASM
공개정보 공개여부 ex) Y
공개정보 URL
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
구조정보
분리원 ex) mouse lung
구조유형 ex) protein structure
등록번호 ex) PDB ID: 3J3A
PDB Format
공개정보 공개여부 ex) Y
공개정보 URL
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
기타
특징
분양 정보 분양여부 ex) 가능
분양정보 URL ex) http://kctc.kribb.re.kr/search/SearchResultReg.aspx
공개정보 공개여부 ex) Y
공개정보 URL
특허 출원번호 ex) 1020050012345
등록번호 ex) 1006894790000
참고문헌
ex) The C. elegans heterochronic gene lin-4 encodes small RNAs with antisense complementarity to lin-14
  • TOP